PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C003212P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 378aa    MW: 40555.4 Da    PI: 5.469
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C003212P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.9e-1757102147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+W++eEd +l ++v ++G ++W++Iar +  gR++k+c++rw + 
   MELO3C003212P1  57 KGPWSPEEDAILSRLVSKFGARNWSLIARGIA-GRSGKSCRLRWCNQ 102
                      79******************************.***********985 PP

2Myb_DNA-binding574.5e-18109153147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T eEd ++v a++ +G++ W++Iar ++ gRt++ +k++w++ 
   MELO3C003212P1 109 RKPFTDEEDRIIVAAHAVHGNK-WAAIARLLP-GRTDNAIKNHWNST 153
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.92252103IPR017930Myb domain
SuperFamilySSF466891.83E-3054150IPR009057Homeodomain-like
SMARTSM007173.2E-1556105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2658110IPR009057Homeodomain-like
CDDcd001671.57E-1459101No hitNo description
PfamPF139212.7E-1660117No hitNo description
PROSITE profilePS5129427.519104158IPR017930Myb domain
SMARTSM007176.0E-17108156IPR001005SANT/Myb domain
CDDcd001677.05E-13111154No hitNo description
Gene3DG3DSA:1.10.10.604.3E-24111157IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MEGTAAPEIG AAAPEVGGVD ACDAVASVAD CGSGDDALPM VGEGEATGGR GGKDRVKGPW  60
SPEEDAILSR LVSKFGARNW SLIARGIAGR SGKSCRLRWC NQLDPSVKRK PFTDEEDRII  120
VAAHAVHGNK WAAIARLLPG RTDNAIKNHW NSTLRRRCTE LERIKLESGN VVDDASLEKT  180
KGSSEETLSC GDVNSFKSMD GKDTCSREHL DDQYEDKVPI FVEGQFSHEV NEQPTLFRPV  240
ARVSAFSVYN PLDGQGSLRP FLRPVPMQGP LIQVSKPDVE ASKFLEGVYG DRSVPHQCGH  300
GCCKSHNQGS PIESLLGPEF VDFSEPPPSF PSFELAAIAT DISNLAWLKS GLENGSVRAM  360
GDSAGRLNGS QMQMGHL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-42511571107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAPTransfer from AT3G09230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818880.0LN681888.1 Cucumis melo genomic scaffold, anchoredscaffold00002.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008448879.10.0PREDICTED: transcription factor MYB86
TrEMBLA0A0A0KXF80.0A0A0A0KXF8_CUCSA; Uncharacterized protein
STRINGVIT_08s0007g01540.t011e-172(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39863362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.11e-93myb domain protein 1